Products

TGF beta 2 (Transforming growth factor-β2), Human

TGF-β2 is a secreted protein known as a cytokine that performs many cellular functions and has a vital role during embryonic development. TGF-β2 signaling begins with binding to a complex of the accessory receptor betaglycan and a type II ser/thr kinase receptor termed TGF-beta RII. This receptor then phosphorylates and activates another ser/thr kinase receptor, TGF-beta RI, or alternatively, ALK-1. The whole complex phosphorylates and activates Smad proteins that regulate transcription (3, 11, 12). Use of other signaling pathways that are Smad-independent allows for disparate actions observed in response to TGF-beta in different contexts.
No. Size Price Qty Status
C01089-20UG 20 ug $268.00 Inquiry
C01089-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYY
IGKTPKIEQLSNMIVKSCKCS with polyhistidine tag at the C-terminus

UnitProt ID:
P61812
 
Source:
Escherichia coli

Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF beta 2 is > 5 x 106 IU/mg.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 2 weeks under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice

   Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.2 ng/mL.
   The specific activity of recombinant human TGF beta 2 is > 5 x 106 IU/mg.
Reviews for TGF beta 2 (Transforming growth factor-β2), Human

Average Rating: 0 (0 Reviews )